PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_14065_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 111aa    MW: 12757.1 Da    PI: 10.9008
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_14065_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1014.4e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+iifs++gklye++s
  Neem_14065_f_1  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.04E-38261No hitNo description
SuperFamilySSF554552.49E-30261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-33323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVALIIFSN RGKLYEFCST  60
SRLLIKDGSL FGKSSVSVVF CTRSVLLIHA LFHSEILKES HRLRMNFLIN V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-20166168Myocyte-specific enhancer factor 2B
1tqe_Q6e-20166168Myocyte-specific enhancer factor 2B
1tqe_R6e-20166168Myocyte-specific enhancer factor 2B
1tqe_S6e-20166168Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3940594e-57GQ394059.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1024 SSR marker CGR6437 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345102.12e-37PREDICTED: MADS-box protein CMB1-like
SwissprotO224567e-38SEP3_ARATH; Developmental protein SEPALLATA 3
SwissprotQ034895e-38AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLS8D4L44e-38S8D4L4_9LAMI; Uncharacterized protein
TrEMBLA0A103XKV52e-37A0A103XKV5_CYNCS; Transcription factor, K-box
TrEMBLM1CAG72e-37M1CAG7_SOLTU; Uncharacterized protein
STRINGPOPTR_0004s11450.12e-37(Populus trichocarpa)
STRINGPGSC0003DMT4000633155e-37(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.32e-39MIKC_MADS family protein